PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00013.1.g08610.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 494aa    MW: 50445.6 Da    PI: 10.2641
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00013.1.g08610.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-38200260262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e  lkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Zjn_sc00013.1.g08610.1.am.mk 200 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 260
                                   56789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-38184258IPR003851Zinc finger, Dof-type
PfamPF027013.0E-32204258IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.609204258IPR003851Zinc finger, Dof-type
PROSITE patternPS013610206242IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MLLLPDIDRS LDQPRVSPHR RLRYSRSTTE QYVRGSAAID ACIPAVFISC IFPAAARAAG  60
MVPTLRPKGN AAVSSGVRAL RASGFSAAFL VHKPLSSSRS EIILSLITSI PCSLAVAQQQ  120
AHHGQLPSAG GGGGGGGVEP HQHQQQHQLP PVPPPGALMA PRPDMAMAGA ASAGGGPTGG  180
SAVRPGSMSE RARLANIPQP EPGLKCPRCE STNTKFCYFN NYSLSQPRHF CKTCRRYWTR  240
GGALRNVPVG GGCRRNKRSK SSKSNSSSAA SASATAGGTS SSTSSTTTGG GSAAATAAIM  300
PPQAQLPFLA SLHQFGGDHY STGASRLGFP GLSSLDPVDY QFRTGGGAGT AIGLEHWRLP  360
QIQQFPFLNR SDGVPPPMPG IYPFDIEGGG DAAGFVGQML AGSKVPGSSG LITQLASVKM  420
EDNNPQSTAM TNSPREFLGL SGSLPFWSGG NGAGGNSNNN GVGANSGGGG GAVGPGSSWV  480
DLAGFNPSSS GNIL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981250.11e-136PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4AAI91e-134K4AAI9_SETIT; Uncharacterized protein
STRINGSi035896m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.24e-45OBF-binding protein 3